PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 470aa    MW: 51532.8 Da    PI: 6.6248
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01870.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.5e-39123183262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++k+l+cprC+s++tkfCyynny+++qPryfCkaC+ryWt+GG++rnvPvG+grrknk+s 
  KHN01870.1 123 PDKILPCPRCNSMDTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVPVGAGRRKNKNSA 183
                 7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30105180IPR003851Zinc finger, Dof-type
PfamPF027012.7E-32125181IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.686127181IPR003851Zinc finger, Dof-type
PROSITE patternPS013610129165IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MQENKDPAIK LFGQKIAFPG EADSQAIAGG ETGSPAMDVD KDEEDFGIGN PDKDEKDKDP  60
RAEKVSEKTK EADPPPDAAD SKTSEGIQNP NTPSIDEESA KSKNDKSEND QQENNNNKTL  120
KKPDKILPCP RCNSMDTKFC YYNNYNVNQP RYFCKACQRY WTAGGTMRNV PVGAGRRKNK  180
NSASHYRHIT ISEALQAARI DAPNGTHLLK QNGRVLSFGL DPPICDSMAS ILNLTAEKKG  240
SLNNNTRNGF HTIEDQRNKD NHNNNNNNGD DCSSASSITV SNEESGKSTS QESIMVPNSN  300
GFIHHVPCIS TLPWPYPFPS AAPAMCPPGF PMSFYPAAFW NIPWFPSQHS HHSAPTPRSP  360
SSGPNSPTLG KHSRDDDAEK QDHLQEESPS RQRNGSVLVP KTLRIDDPSE AAKSSIWATL  420
GIKNECVTGG GMFKGFQSKK DEKDHVVEAS PVLRANPAAL SRSLNFHENS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578570.10.0PREDICTED: cyclic dof factor 3-like
SwissprotQ8LFV31e-127CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A0B2NXU50.0A0A0B2NXU5_GLYSO; Dof zinc finger protein DOF3.3
STRINGGLYMA04G33410.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-125cycling DOF factor 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]